HLX-038 · Reproductive axis
VIP
Vasoactive Intestinal Peptide
29 in Union stock14:00 Union cut-off
CoA for HLX-VIP-2609-A is listed on
Skip, pause or cancel any shipment. Laboratories only — not a protocol.
ex VAT
59,84 €
68,00 €
−12% · Union dispatch included
Code WELCOME10 is 15% on a first order over €40. SEPA / open banking / BTC another 5%.
lyophilised
VIP is a synthetic 28-residue neuropeptide of the glucagon/secretin superfamily and an agonist at the VPAC1 and VPAC2 receptors, studied in laboratory research for cAMP signalling, smooth muscle relaxation and immunomodulation. Supplied as a lyophilised acetate-salt powder for controlled research use.
Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2Dispatch, VAT, reconstitution
- Cut-off 14:00 Union, 2–5 working days, DHL/DPD.
- EUR prices ex VAT. 21% unless a valid EU VAT ID on an ICS.
- Free Union dispatch from €250. FREESHIP from €80.
- No reconstitution or injection advice. Laboratory use only.
Not for human or veterinary use. Not a medicinal product. Invoiced in EUR, ex VAT.
Lot file before checkout
Five things on the lot file
HLX-VIP-2609-A
Purity
≥98% HPLC
The tall peak is the named compound. The small rises are everything else in the vial. That difference is HPLC purity — a number, not a badge. It is not net peptide content.
Lot notes
Carton arrived, CoA matches the lot on the vial. Not a result. Not a protocol.
No signed-in notes on this lot yet.
